Loading...
Search Results for: Kimike dhe shërbimet farmaceutike
Kompanitë e gjetura 546globalcatalog.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... Lexo më shumë »
- Objekteve industriale - design | Konsulentët teknologji Powder | Llak tharje shërbime për industrinë ushqimore | Llak th...
- Tonbridge
- Mbretëria e Bashkuar
globalcatalog.com/kellyservices.fr
- Konsulentët meteorologjike | Konsulentët energji avulli | Konsulentët Gjeofizikë | Hidrogjeologjia konsulentët | Kons...
- Clichy
- Francë
globalcatalog.com/sweco.us
- Sieving e solids për industrinë kimike | Humidifiers, miell, vaj ushqimor perimeve | Heaters, oilseed ngrënshëm | Paj...
- Florence
- Shtetet e Bashkuara të Amerikës
globalcatalog.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Lexo më shumë »
- Sieving e lëngjeve për industrinë kimike | Sieving e solids për industrinë kimike | Sieving i pastave për industrinë kim...
- Stoke On Trent
- Mbretëria e Bashkuar
globalcatalog.com/upgreensas.fr
globalcatalog.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Lexo më shumë »
- Rigjenerimin e katalizatorëve | Shërbimet e rigjenerimit për aktivizimit të karbonit | Rimëkëmbjes dhe rigjenerimi i kim...
- London
- Mbretëria e Bashkuar
globalcatalog.com/sofresidengineering.fr
- Kontraktuesit gypave, kimike dhe sistemet bërthamore rrjedhës | Kontraktuesit instalimin Gypat, fabrikë kimike | Ko...
- Montigny-le-Bretonneux
- Francë
globalcatalog.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... Lexo më shumë »
- Shërbimet e klasifikimit, kimikatet gjobë | Kimikatet gjobë | Kimikateve të tjera të bukura | Ekstraktet
- Changsha
- Kinë
globalcatalog.com/univar.fr
- Kimikatet - import-eksport | Shërbimet e pastrimit proteinave | Sieving i pastave për industrinë kimike | Klasifikimit s...
- Fontenay-sous-Bois
- Francë
globalcatalog.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... Lexo më shumë »
- Kozmetikë përpunimit | Ilaç bimor | Ilaçe bimor | Produkte te kujdesit personal | Men Kujdesi | Kozmetikë
- Ambala City
- Indi
globalcatalog.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Lexo më shumë »
- Prodhimi i produkteve të tjera kimike n.e.c. | Gjeneratorë të klorit për pishina | Produktet kimike | Prodhimi i kem...
- Yanggu
- Kinë
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Lexo më shumë »
- Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje e farmaceutike | Shërbimet e pa...
- Bengaluru
- Indi
globalcatalog.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Lexo më shumë »
- Prodhimi i produkteve të tjera kimike n.e.c. | Produktet kimike | Bromine, të ngurta, të lëngshme ose të gazta
- Weifang
- Kinë
globalcatalog.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Lexo më shumë »
- Prodhimi i pesticideve dhe produkteve të tjera agrochemical | Agrochemicals | Agrochemical | Agrochemicals tjera dhe ...
- Jinxi
- Kinë
globalcatalog.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Lexo më shumë »
- Poliuretani (pu) | Polimere | Tretësit | Prodhimi i produkteve të tjera kimike | Prodhimi i kemikateve dhe produkteve k...
- Karachi
globalcatalog.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... Lexo më shumë »
- Custom kimike Shërbimet | Valvulave Ball | Produkteve plastike | Ngjitëse dhe kasetë | Formohem komponente, fused ku...
- Ahmedabad
- Indi
globalcatalog.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Lexo më shumë »
- Prodhimi i ngjyra dhe pigmente | Prodhimin e bojrave, llaqe dhe veshje të ngjashme, ngjyrë shtypje dhe mastice | Bojra d...
- Xochitepec
- Meksikë
globalcatalog.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Lexo më shumë »
- Prodhimi i kimikateve | Kimikatet
- Noida
- Indi
globalcatalog.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... Lexo më shumë »
- Përzierja e farmaceutike | Përgatitjet për çrregullime të sistemit nervor, qetësues, qetësues, mjekësi kineze | Përgati...
- Hyderabad
- Indi
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Lexo më shumë »
- Shërbimet e prodhimit, shtojcave dietike | Plotësimi dhe Packaging shërbimeve, tretës dhe ngjitëse, industriale | Përz...
- New Delhi
- Indi
globalcatalog.com/lgobbisrl.it
- Shërbimet e prodhimit, shtojcave dietike | Rigjenerimin e katalizatorëve | Shërbimet e rigjenerimit për aktivizimit të k...
- CAMPO LIGURE (GE)
- Itali
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Lexo më shumë »
- Rimëkëmbjes dhe rigjenerimi i komponimeve organike të paqëndrueshme (VOC) | Shërbimet e pastrimit proteinave | Sieving e...
- Rajagiriya
globalcatalog.com/developpementbernardplasencia.fr
- Konsulentëve farmaceutike inxhinieri e prodhimit | Konsulentët inxhinieri biokimike | Shërbimet e rigjenerimit për akt...
- Saint-Priest
- Francë
globalcatalog.com/aircontrolsa.es
- Bimore ftohjes, projektet e gardian | Shërbimet e prodhimit, shtojcave dietike | Përzierja e farmaceutike | Llak tharje ...
- San Sebastián
- Spanjë
globalcatalog.com/borgessa.es
- Grouting, suva të bazuar | Shërbimet e prodhimit, shtojcave dietike | Tregtarët mall, Goma të para dhe latex | Tre...
- Reus
- Spanjë
globalcatalog.com/crealis.fr
- Këshilla Menaxhimi | Fermentimi i kimikateve | Pastrimi produkte kimike, për instalimet elektrike dhe elektronike | P...
- Bry
- Francë
globalcatalog.com/azelisfrance.fr
- Shërbimet e prodhimit, shtojcave dietike | Kimikatet - import-eksport | Përzierja e farmaceutike | Llak tharje e f...
- Paris
- Francë
globalcatalog.com/epiingredients.fr
- Përzierja e farmaceutike | Përzierja e ngjyra dhe pigmente për industrinë kimike | Vaj xhenxhefil | Qumësht pluhur dhe k...
- Ancenis
- Francë
globalcatalog.com/ktronfrance.fr
- Shërbimet e prodhimit, shtojcave dietike | Plotësimi dhe Packaging shërbimeve, tretës dhe ngjitëse, industriale | Përz...
- Croissy-sur-Celle
- Francë
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Lexo më shumë »
- Përzierjen dhe përzierja konsulentë Inxhinieri Teknologji | Shërbimet e prodhimit, shtojcave dietike | Përzierja e farm...
- Runcorn
- Mbretëria e Bashkuar