Loading...
Search Results for: Chemical and pharmaceutical services
Found 546 companiesglobalcatalog.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... Read More »
- Industrial facilities - design | Powder technology consultants | Spray drying services for the food industry | Spray...
- Tonbridge
- United Kingdom
globalcatalog.com/kellyservices.fr
- Meteorological consultants | Steam power consultants | Geophysics consultants | Hydrogeology consultants | Groundwater...
- Clichy
- France
globalcatalog.com/sweco.us
- Sieving of solids for the chemical industry | Humidifiers, meal, edible vegetable oil processing | Heaters, edible...
- Florence
- United States
globalcatalog.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Read More »
- Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
- Stoke On Trent
- United Kingdom
globalcatalog.com/upgreensas.fr
globalcatalog.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Read More »
- Regeneration of catalysts | Regeneration services for activated carbon | Recovery and regeneration of photographic...
- London
- United Kingdom
globalcatalog.com/sofresidengineering.fr
- Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
- Montigny-le-Bretonneux
- France
globalcatalog.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... Read More »
- Classification services, fine chemicals | Fine chemicals | Other fine chemicals | Extracts
- Changsha
- China
globalcatalog.com/univar.fr
- Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
- Fontenay-sous-Bois
- France
globalcatalog.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... Read More »
- Cosmetics processing | Herbal medicine | Herbal medicines | Personal care products | Men care | Cosmetics
- Ambala City
- India
globalcatalog.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Read More »
- Manufacture of other chemical products n.e.c. | Chlorine generators for swimming pools | Chemical products |...
- Yanggu
- China
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bengaluru
- India
globalcatalog.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Read More »
- Manufacture of other chemical products n.e.c. | Chemical products | Bromine, solid, liquid or gaseous
- Weifang
- China
globalcatalog.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Read More »
- Manufacture of pesticides and other agrochemical products | Agrochemicals | Agrochemical | Other agrochemicals and...
- Jinxi
- China
globalcatalog.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Read More »
- Polyurethane (PU) | Polymers | Solvents | Manufacture of other chemical products | Manufacture of chemicals and...
- Karachi
- Pakistan
globalcatalog.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... Read More »
- Custom chemical services | Ball valves | Plastic products | Adhesives and tape | Moulded components, fused quartz
- Ahmedabad
- India
globalcatalog.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Read More »
- Manufacture of dyes and pigments | Manufacture of paints, varnishes and similar coatings, printing ink and mastics |...
- Xochitepec
- Mexico
globalcatalog.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Read More »
- Production of chemicals | Chemicals
- Noida
- India
globalcatalog.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... Read More »
- Blending of pharmaceuticals | Preparations for nervous system disorders, sedatives, tranquillisers, Chinese medicine |...
- Hyderabad
- India
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- New Delhi
- India
globalcatalog.com/lgobbisrl.it
- Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
- CAMPO LIGURE (GE)
- Italy
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
globalcatalog.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
globalcatalog.com/aircontrolsa.es
- Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
- San Sebastián
- Spain
globalcatalog.com/borgessa.es
- Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
- Reus
- Spain
globalcatalog.com/crealis.fr
- Management advice | Distillation of chemicals | Cleaning products, chemical, for electric and electronic installations...
- Bry
- France
globalcatalog.com/azelisfrance.fr
- Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
- Paris
- France
globalcatalog.com/epiingredients.fr
- Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
- Ancenis
- France
globalcatalog.com/ktronfrance.fr
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- Croissy-sur-Celle
- France
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
- Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
- Runcorn
- United Kingdom