Loading...
Søgeresultater for: kemisk og farmaceutisk service
Gevonden 546 bedrijvenglobalcatalog.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... Lees meer »
- Industrielle faciliteter - konstruktion | Pulverteknologi, rådgivere | Sprøjtetørringsservice, levnedsmiddelindustrien |...
- Tonbridge
- Storbritannien
globalcatalog.com/kellyservices.fr
- Meteorologiske rådgivere | Dampkraft, rådgivere | Geofysik, tekniske rådgivere | Hydrogeologi, tekniske rådgivere | Gru...
- Clichy
- Frankrig
globalcatalog.com/sweco.us
- Sigtning af faststoffer til den kemiske industri | Melbefugtere til oparbejdning af vegetabilsk spiseolie |...
- Florence
- USA
globalcatalog.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Lees meer »
- Sining af væsker til den kemiske industri | Sigtning af faststoffer til den kemiske industri | Sining af pastaer til ...
- Stoke On Trent
- Storbritannien
globalcatalog.com/upgreensas.fr
globalcatalog.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... Lees meer »
- Regenerering af katalysatorer | Regeneration af aktivt kul | Genvinding og regenerering af fotografiske kemikalier |...
- London
- Storbritannien
globalcatalog.com/sofresidengineering.fr
- Rørledningsarbejde, kemiske og nukleare spildevandssystemer | Rørinstallationer til kemiske anlæg | Rørinstallationer ti...
- Montigny-le-Bretonneux
- Frankrig
globalcatalog.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... Lees meer »
- Klassificering af rene kemikalier | Finkemikalier | Andre finkemikalier | Uddrag
- Changsha
- Kina
globalcatalog.com/univar.fr
- Kemikalier - import-eksport | Proteinrensning | Sining af pastaer til den kemiske industri | Klassificering og...
- Fontenay-sous-Bois
- Frankrig
globalcatalog.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... Lees meer »
- Kundespecificeret behandling og forarbejdning af kosmetiske produkter | Urtemedicin | Urtemedicin | Produkter til...
- Ambala City
- Indien
globalcatalog.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... Lees meer »
- Fremstilling af andre kemiske produkter i.a.n. | Chlorgeneratorer til svømmebassiner | Kemikalier og kemiske produkter ...
- Yanggu
- Kina
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Lees meer »
- Produktion af kosttilskud | Blanding af farmaceutiske produkter | Spraytørring af farmaceutiske produkter | ...
- Bengaluru
- Indien
globalcatalog.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... Lees meer »
- Fremstilling af andre kemiske produkter i.a.n. | Kemikalier og kemiske produkter | Brom, fast, flydende eller gasformig
- Weifang
- Kina
globalcatalog.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... Lees meer »
- Fremstilling af pesticider og andre agrokemiske produkter | Landbrugskemikalier | Agrokemiske | Andre...
- Jinxi
- Kina
globalcatalog.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... Lees meer »
- Polyurethan (PU) | Polymerer | Opløsningsmidler | Fremstilling af andre kemiske produkter | Fremstilling af kemiske ...
- Karachi
- Pakistan
globalcatalog.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... Lees meer »
- Custom kemiske tjenester | Kugleventiler | Plastprodukter | Lim og tape | Formstøbte komponenter, smeltet kvarts
- Ahmedabad
- Indien
globalcatalog.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... Lees meer »
- Fremstilling af farvestoffer og pigmenter | Fremstilling af maling, lak og lignende overfladebehandlingsmidler,...
- Xochitepec
- Mexico
globalcatalog.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... Lees meer »
- Fremstilling af kemikalier | Kemikalier
- Noida
- Indien
globalcatalog.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... Lees meer »
- Blanding af farmaceutiske produkter | Præparater mod lidelser i nervesystemet, kinesisk medicin | Præparater mod e...
- Hyderabad
- Indien
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Lees meer »
- Produktion af kosttilskud | Fyldning og emballering af opløsningsmidler og klæbestoffer til industribrug | Blanding af f...
- New Delhi
- Indien
globalcatalog.com/lgobbisrl.it
- Produktion af kosttilskud | Regenerering af katalysatorer | Regeneration af aktivt kul | Genvinding og regenerering af...
- CAMPO LIGURE (GE)
- Italien
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Lees meer »
- Genvinding af flygtige organiske forbindelser | Proteinrensning | Sining af væsker til den kemiske industri | Sining af ...
- Rajagiriya
- Sri Lanka
globalcatalog.com/developpementbernardplasencia.fr
- Farmaceutisk produktion, tekniske rådgivere | Biokemi, tekniske rådgivere | Regeneration af aktivt kul | Genvinding af f...
- Saint-Priest
- Frankrig
globalcatalog.com/aircontrolsa.es
- Køleanlæg, nøglefærdige projekter | Produktion af kosttilskud | Blanding af farmaceutiske produkter | Spraytørring af fa...
- San Sebastián
- Spanien
globalcatalog.com/borgessa.es
- Injektionsmørtel, gipsbaseret | Produktion af kosttilskud | Råvaregrossister, rågummi og latex | Råvaregrossister, råo...
- Reus
- Spanien
globalcatalog.com/crealis.fr
- Management rådgivning | Destillation af kemikalier | Rengøringsmidler, kemiske, til elektriske og elektroniske i...
- Bry
- Frankrig
globalcatalog.com/azelisfrance.fr
- Produktion af kosttilskud | Kemikalier - import-eksport | Blanding af farmaceutiske produkter | Spraytørring af ...
- Paris
- Frankrig
globalcatalog.com/epiingredients.fr
- Blanding af farmaceutiske produkter | Blanding af maling og pigmenter til den kemiske industri | Ingefærolie | ...
- Ancenis
- Frankrig
globalcatalog.com/ktronfrance.fr
- Produktion af kosttilskud | Fyldning og emballering af opløsningsmidler og klæbestoffer til industribrug | Blanding af f...
- Croissy-sur-Celle
- Frankrig
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Lees meer »
- Blandeteknologi, tekniske rådgivere | Produktion af kosttilskud | Blanding af farmaceutiske produkter | Spraytørring af ...
- Runcorn
- Storbritannien