Loading...
के लिए खोज परिणाम: रसायन और दवा सेवाओं
मिली 546 कंपनियांglobalcatalog.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... और पढ़ें »
- औद्योगिक सुविधाओं के डिजाइन - | पाउडर प्रौद्योगिकी सलाहकार | खाद्य उद्योग के लिए सुखाने सेवाओं स्प्रे | दवाइयों के सूखने...
- Tonbridge
- ब्रितन
globalcatalog.com/kellyservices.fr
- मौसम विज्ञान सलाहकार | भाप बिजली सलाहकार | भूभौतिकी सलाहकार | हाइड्रोज्योलोजी सलाहकार | भूजल विकास सलाहकार | आनुवंशिक जै...
- Clichy
- फ्रांस
globalcatalog.com/sweco.us
- रसायन उद्योग के लिए ठोस sieving | Humidifiers, भोजन, खाद्य वनस्पति तेल प्रसंस्करण | हीटर, खाद्य तिलहन | खाद्य तिलहन के ल...
- Florence
- संयुक्त राज्य अमेरिका
globalcatalog.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... और पढ़ें »
- रसायन उद्योग के लिए तरल पदार्थ की sieving | रसायन उद्योग के लिए ठोस sieving | रसायन उद्योग के लिए चिपकाता sieving | Humi...
- Stoke On Trent
- ब्रितन
globalcatalog.com/upgreensas.fr
globalcatalog.com/johnsonmattheyfuelcellslimited.gb
Export Johnson Matthey is a speciality chemicals company focussed on its core skills in precious metals, catalysts and fine chemicals. It is organised into three global divisions: Environmental... और पढ़ें »
- उत्प्रेरक का उत्थान | सक्रिय कार्बन के उत्थान सेवाओं | फोटो रसायन की वसूली और उत्थान | वसूली और औद्योगिक तेल का शोधन | द...
- London
- ब्रितन
globalcatalog.com/sofresidengineering.fr
- Pipework ठेकेदारों, रासायनिक और परमाणु प्रवाह प्रणालियों | Pipework स्थापना ठेकेदारों, रासायनिक संयंत्र | Pipework स्थाप...
- Montigny-le-Bretonneux
- फ्रांस
globalcatalog.com/worldwaybiotech.cn
World-Way is specialized in marketing plant-derived extracts and fine chemicals for the nutraceutical, food and cosmetic industries for 15 years. World-Way is founded by Dr. Ginkgo Zeng, Professor in... और पढ़ें »
- वर्गीकरण सेवाओं, ठीक रसायन | ठीक रसायन | अन्य रसायन | अर्क...
- Changsha
- चीन
globalcatalog.com/univar.fr
- रसायन - आयात निर्यात | प्रोटीन शुद्धि सेवाएं | रसायन उद्योग के लिए चिपकाता sieving | रसायन उद्योग के लिए एयर वर्गीकरण से...
- Fontenay-sous-Bois
- फ्रांस
globalcatalog.com/mediwelllaboratories.in
We are An ISO 9001:2015 , certified and is listed on all Drug updates. Our sister concern are Mediwell wellness , mediwell wellness & Phytomolecules Marcwell Laboratories , All of our... और पढ़ें »
- प्रसाधन सामग्री प्रसंस्करण | हर्बल दवा | हर्बल दवाओं | पर्सनल केयर उत्पादों | पुरुषों की देखभाल | प्रसाधन सामग्री...
- Ambala City
- भारत
globalcatalog.com/shandongsunshinechemicaltechnologyco.cn
Shandong Sunshine Chemical Technology Co., Ltd. specializes in R&D, production and management of disinfectant, additives and polymer, and its factory was built in accordance with GMP standards.... और पढ़ें »
- अन्य रसायन उत्पादों के निर्माण n.e.c. | स्विमिंग पूल के लिए क्लोरीन जनरेटर | रासायनिक उत्पादों | रसायन और रासायनिक उत्पा...
- Yanggu
- चीन
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... और पढ़ें »
- उत्पादन सेवाओं, पूरक आहार | दवाइयों का सम्मिश्रण | दवाइयों के सूखने स्प्रे | प्रोटीन शुद्धि सेवाएं | मानव हार्मोन का निष...
- Bengaluru
- भारत
globalcatalog.com/shandongrunkechemicalco.cn
Shandong Runke Chemical Co., Ltd. was established in 2006 and finished holding and restructuring of Weifang Dacheng Salinization Co., Ltd. to the company in 2010. With a registered capital of 40... और पढ़ें »
- अन्य रसायन उत्पादों के निर्माण n.e.c. | रासायनिक उत्पादों | , ब्रोमिन ठोस, द्रव या गैसीय...
- Weifang
- चीन
globalcatalog.com/northeastagrochem.cn
Agrochemicals products.
Main products: Malathion, Chlorpyrifos, Thiamethoxam, and others. (Technical and Formulation)
Aгрохимикатов продукции.
Основная продукция: Малатион, Хлорпирифос, Тиаметокса... और पढ़ें »
- कीटनाशकों और अन्य agrochemical उत्पादों का विनिर्माण | एग्रोकेमिकल्स | एग्रोकेमिकल | अन्य agrochemicals और कीटनाशकों | ए...
- Jinxi
- चीन
globalcatalog.com/chemiplastinternational.pk
Chemiplast International is a strong, family rooted company – founded by a cotton trading veteran Mr. Abid Ali (late) in 1999 with a vision to make Chemiplast one of the leading trading companies ... और पढ़ें »
- Polyurethane (पु) | पॉलिमर | सॉल्वैंट्स | अन्य रासायनिक उत्पादों का विनिर्माण | रसायन और रासायनिक उत्पादों का विनिर्माण...
- Karachi
- पाकिस्तान
globalcatalog.com/varunpolymers.in
Varun Polymers is one of the leading manufacturer and exporter in India, of premium quality recycled rubber products. We manufacture rubber reclaiming agent such as:
1 Di Aryl Di Sulphide
2 ... और पढ़ें »
- कस्टम केमिकल सेवा | गेंद वाल्व | प्लास्टिक उत्पादों | चिपकने वाले और टेप | ढलवां घटकों, क्वार्ट्ज जुड़े हुए...
- Ahmedabad
- भारत
globalcatalog.com/texmor.mx
In 1981, the painting factory Permil S.A. of C.V. I think you will sit in the market of the surest. Our mission is to protect and decorate beautifully designed motifs for the three brothers, written... और पढ़ें »
- रंग और pigments के निर्माण | पेंट, वार्निश और समान कोटिंग्स, मुद्रण स्याही और mastics का निर्माण | पेंट्स और प्राइमरों...
- Xochitepec
- मेक्सिको
globalcatalog.com/gujaratfluorochemicalslimited.in
Gujarat Fluorochemicals Limited (GFL) is an Indian Chemicals Company with over 30 years of expertise in Fluorine Chemistry. GFL holds domain expertise in Fluoropolymers, Fluorospecialities,... और पढ़ें »
- रसायनों का उत्पादन | रसायन
- Noida
- भारत
globalcatalog.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... और पढ़ें »
- दवाइयों का सम्मिश्रण | तंत्रिका तंत्र संबंधी विकार, बनी रहती, शांति, चीनी चिकित्सा के लिए तैयारी | Endocrine विकारों, ची...
- Hyderabad
- भारत
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... और पढ़ें »
- उत्पादन सेवाओं, पूरक आहार | सेवाओं, सॉल्वैंट्स और चिपकने, औद्योगिक भरने और पैकेजिंग | दवाइयों का सम्मिश्रण | दवाइयों के ...
- New Delhi
- भारत
globalcatalog.com/lgobbisrl.it
- उत्पादन सेवाओं, पूरक आहार | उत्प्रेरक का उत्थान | सक्रिय कार्बन के उत्थान सेवाओं | फोटो रसायन की वसूली और उत्थान | वसूली...
- CAMPO LIGURE (GE)
- इटली
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... और पढ़ें »
- वसूली और वाष्पशील कार्बनिक यौगिकों के उत्थान (VOC) | प्रोटीन शुद्धि सेवाएं | रसायन उद्योग के लिए तरल पदार्थ की sieving |...
- Rajagiriya
- श्रीलंका
globalcatalog.com/developpementbernardplasencia.fr
- औषधि उत्पादन इंजीनियरिंग सलाहकार | बायोकेमिकल इंजीनियरिंग सलाहकार | सक्रिय कार्बन के उत्थान सेवाओं | वसूली और वाष्पशील क...
- Saint-Priest
- फ्रांस
globalcatalog.com/aircontrolsa.es
- शीतलक संयंत्र, टर्नकी परियोजनाओं | उत्पादन सेवाओं, पूरक आहार | दवाइयों का सम्मिश्रण | दवाइयों के सूखने स्प्रे | प्रोटीन ...
- San Sebastián
- स्पेन
globalcatalog.com/borgessa.es
- ग्राउटिंग, प्लास्टर आधार | उत्पादन सेवाओं, पूरक आहार | कमोडिटी व्यापारियों, कच्ची रबर और लेटेक्स | कमोडिटी व्यापारियों, ...
- Reus
- स्पेन
globalcatalog.com/crealis.fr
- प्रबंधन सलाह | रसायनों के आसवन | बिजली और इलेक्ट्रॉनिक प्रतिष्ठानों के लिए, उत्पाद, रसायन सफाई | डाटा प्रोसेसिंग के लिए ...
- Bry
- फ्रांस
globalcatalog.com/azelisfrance.fr
- उत्पादन सेवाओं, पूरक आहार | रसायन - आयात निर्यात | दवाइयों का सम्मिश्रण | दवाइयों के सूखने स्प्रे | प्रोटीन शुद्धि सेवाए...
- Paris
- फ्रांस
globalcatalog.com/epiingredients.fr
- दवाइयों का सम्मिश्रण | रसायन उद्योग के लिए पेंट और pigments के सम्मिश्रण | अदरक का तेल | पाउडर और गाढ़ा दूध | पेय उद्योग...
- Ancenis
- फ्रांस
globalcatalog.com/ktronfrance.fr
- उत्पादन सेवाओं, पूरक आहार | सेवाओं, सॉल्वैंट्स और चिपकने, औद्योगिक भरने और पैकेजिंग | दवाइयों का सम्मिश्रण | दवाइयों के ...
- Croissy-sur-Celle
- फ्रांस
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... और पढ़ें »
- प्रौद्योगिकी इंजीनियरिंग सलाहकार मिश्रण और मेल | उत्पादन सेवाओं, पूरक आहार | दवाइयों का सम्मिश्रण | दवाइयों के सूखने स्प...
- Runcorn
- ब्रितन