Loading...
Rezultate căutare pentru: Echipament de tipărire şi de grafică
Companii 277 găsiteAnunturi preferate legate de: Echipament de tipărire şi de grafică
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Citește mai mult »
- Prelucrarea saci de mașini | Echipament de tipărire şi de grafică | Maşini şi echipamente de sortare a hârtiei | Dispoz...
- Hyderabad
- India
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Amravati
- India
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Mumbai
- India
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Faridabad
- India
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Citește mai mult »
- Alte echipamente pentru modelarea îmbrăcăminte | Echipament de tipărire şi de grafică | Maşini cu sită cilindrică, pentr...
- Mumbai
- India
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Bardoli
- India
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Ahmedabad
- India
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Pune
- India
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Kalol
- India
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Echipament de tipărire şi de grafică | Maşini de tipărit plano-cilindrice cu o singură rotaţie | Maşini de tipărit plano...
- Wadhwan
- India
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Citește mai mult »
- Genti | Vaporizatoare cu abur umed, pentru industria textilă | Vaporizatoare cu abur uscat, pentru industria textilă | A...
- New Delhi
- India
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Citește mai mult »
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Ilkal
- India
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Importatori-exportatori de hârtie | Hârtie igienică | Şerveţele de masă, batiste şi şerveţele de faţă din vată de celulo...
- Jodhpur
- India
globalcatalog.com/laxmiudyog.in
- Dealeri produse de securitate | Transfer de imprimare | Servicii de formare prin injecţie, pentru metale | Materiale ...
- Mumbai
- India
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Citește mai mult »
- Racorduri | Supape cu bilă | Vane fluture | Curele pentru transportoare, ciment fibros | Produse din ciment fibros, ...
- Howrah
- India
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Citește mai mult »
- Echipament de tipărire şi de grafică | Echipament de prelucrare a produselor din hârtie | Imprimante și lianți
- Ahmedabad
- India
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Citește mai mult »
- Stretch pelicule | Echipament de tipărire şi de grafică | Utilaje de ambalare
- Wenzhou
- China
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Citește mai mult »
- Echipament de tipărire şi de grafică | Echipament de prelucrare a produselor din hârtie | Maşini-unelte de frezat meta...
- Cangzhou
- China
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Citește mai mult »
- Echipament de tipărire şi de grafică | Laser
- Shenzhen
- China
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Citește mai mult »
- Echipamente de curățare | Echipament de tipărire şi de grafică
- Taixing
- China
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Citește mai mult »
- Echipament de tipărire şi de grafică | Alte materiale de manipulare
- Wenzhou
- China
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Citește mai mult »
- Prelucrarea saci de mașini | Echipament de tipărire şi de grafică
- Ruian
- China
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Citește mai mult »
- Prelucrarea saci de mașini | Echipament de tipărire şi de grafică
- Ruian
- China
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Citește mai mult »
- Prelucrarea saci de mașini | Echipament de tipărire şi de grafică
- Ruian
- China
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Citește mai mult »
- Echipament de tipărire şi de grafică | Utilaje de prelucrare a produselor din hârtie
- Dongguan
- China
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Citește mai mult »
- Saci şi săculeţe | Maşini de cusut | Echipament de tipărire şi de grafică | Utilaje de ambalare
- Wenzhou
- China
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Citește mai mult »
- Alte utilaje textile | Echipament de tipărire şi de grafică
- Ahmedabad
- India
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Citește mai mult »
- Prelucrarea saci de mașini | Echipament de tipărire şi de grafică | Utilaje de ambalare
- Vadodara
- India
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Citește mai mult »
- Utilaje de finisare a textilelor | Echipament de tipărire şi de grafică | Utilaje de ambalare
- Ahmedabad
- India
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Citește mai mult »
- Echipament de tipărire şi de grafică | Ciment sac | Echipament electric şi electronic
- Ahmedabad
- India