Leitarniðurstöður fyrir: Prentun og grafík búnaður
Fundust 277 fyrirtækiPreferred skráningar tengdar: Prentun og grafík búnaður
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Lesa meira »
- Poki gerð véla | Prentun og grafík búnaður | Pappír flokkun vélar og búnaður | Stackers fyrir vinnslu pappír | Tel vélar...
- Hyderabad
- Indland
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Amravati
- Indland
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Mumbai
- Indland
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Faridabad
- Indland
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Lesa meira »
- Annað fatnaður vélar | Prentun og grafík búnaður | Umbúðum vélar, stöðugur, strokka tegund | Syllinderformere fyrir fram...
- Mumbai
- Indland
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Bardoli
- Indland
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Ahmedabad
- Indland
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Pune
- Indland
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Kalol
- Indland
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Prentun og grafík búnaður | Prentun pressur, Roller tegund, með einni snúa | Prentun pressur, Roller tegund, með tveim...
- Wadhwan
- Indland
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Lesa meira »
- Töskur | Våtdampingsmaskiner, textíliðnaði | Tørrdampingsmaskiner, textíliðnaði | Gufu vélar, lágur þrýstingur, textílið...
- New Delhi
- Indland
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Lesa meira »
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Ilkal
- Indland
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Innflytjendur og útflytjendur, pappír | Salernispappír | Servíettur, vasaklútar og andliti vefjum, sellulósa efni | Sale...
- Jodhpur
- Indland
globalcatalog.com/laxmiudyog.in
- Öryggi vöru lyf | Flytja prentun | Innspýting mótun úr málmi | Einangrunarefni | Vor - eftir teikningu | Tengi | pípur |...
- Mumbai
- Indland
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Lesa meira »
- Tengi | Boltinn lokar | Butterfly lokar | Færibönd, trefjar sement | Trefjar sement vörur, fast eld | Prentun og grafík ...
- Howrah
- Indland
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Lesa meira »
- Prentun og grafík búnaður | Pappír vinnslu vélar | Prentarar og bindiefni
- Ahmedabad
- Indland
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Lesa meira »
- Teygja kvikmynd | Prentun og grafík búnaður | Pökkun vélar
- Wenzhou
- Kína
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Lesa meira »
- Prentun og grafík búnaður | Pappír vinnslu vélar | Vélar fyrir málm milling
- Cangzhou
- Kína
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Lesa meira »
- Prentun og grafík búnaður | Leysir búnað
- Shenzhen
- Kína
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Lesa meira »
- Hreinsun búnaðar | Prentun og grafík búnaður
- Taixing
- Kína
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Lesa meira »
- Prentun og grafík búnaður | Annað efni meðhöndlun búnaðar
- Wenzhou
- Kína
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Lesa meira »
- Poki gerð véla | Prentun og grafík búnaður
- Ruian
- Kína
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Lesa meira »
- Poki gerð véla | Prentun og grafík búnaður
- Ruian
- Kína
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Lesa meira »
- Poki gerð véla | Prentun og grafík búnaður
- Ruian
- Kína
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Lesa meira »
- Prentun og grafík búnaður | Pappír vöru gerð véla
- Dongguan
- Kína
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Lesa meira »
- Sekkir og pokar | Saumavélar | Prentun og grafík búnaður | Pökkun vélar
- Wenzhou
- Kína
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Lesa meira »
- Aðrar textíl vélar | Prentun og grafík búnaður
- Ahmedabad
- Indland
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Lesa meira »
- Poki gerð véla | Prentun og grafík búnaður | Pökkun vélar
- Vadodara
- Indland
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Lesa meira »
- Textíl-klára vélar | Prentun og grafík búnaður | Pökkun vélar
- Ahmedabad
- Indland
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Lesa meira »
- Prentun og grafík búnaður | Sement töskur | Rafmagns-og rafeindabúnaði
- Ahmedabad
- Indland