Loading...
نتایج جستجو برای: چاپ و تجهیزات گرافیک
شرکت 277 یافتلیست ترجیحی مربوط به: چاپ و تجهیزات گرافیک
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... ادامه مطلب »
- کیسه های ساخت ماشین آلات | چاپ و تجهیزات گرافیک | ماشین آلات و تجهیزات مرتب سازی مقاله | ماشین آلات ساخت و ساز (layboys)...
- Hyderabad
- هند
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Amravati
- هند
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Mumbai
- هند
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Faridabad
- هند
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... ادامه مطلب »
- ماشین آلات پوشاک دیگر | چاپ و تجهیزات گرافیک | ساخت ماشین آلات مقوا، مستمر، استوانه | قالب، استوانه، مقوا سازی | ماشین C...
- Mumbai
- هند
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Bardoli
- هند
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Ahmedabad
- هند
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Pune
- هند
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Kalol
- هند
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- چاپ و تجهیزات گرافیک | پرس چاپ، سیلندر، تک انقلاب | پرس چاپ، سیلندر، دو انقلاب | پرس چاپ، سیلندر، توقف سیلندر | چاپ پرس،...
- Wadhwan
- هند
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... ادامه مطلب »
- کیف | ماشین بخار مرطوب، نساجی | ماشین بخار خشک، نساجی | بخار لوازم خانگی، کم فشار، نساجی | جعبه های بخار، پارچه و لباس |...
- New Delhi
- هند
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... ادامه مطلب »
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Ilkal
- هند
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- واردکنندگان، صادرکنندگان، کاغذ | دستمال توالت | دستمال، دستمال و دستمال کاغذی، اوات سلولز، | دستمال توالت، moisturised |...
- Jodhpur
- هند
globalcatalog.com/laxmiudyog.in
- عوامل محصول امنیت | چاپ انتقال | خدمات تزریق قالب ریزی و سازه های فلزی | عایق های حرارتی | طراحی سفارشی چشمه | کوپلینگ |...
- Mumbai
- هند
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... ادامه مطلب »
- کوپلینگ | دریچه های توپ | دریچه های پروانه | تسمه نقاله، الیاف سیمان | محصولات فیبر سیمان، مقاوم در برابر آتش | چاپ و تج...
- Howrah
- هند
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... ادامه مطلب »
- چاپ و تجهیزات گرافیک | مقاله ماشین آلات پردازش | چاپگر و کلاسور
- Ahmedabad
- هند
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... ادامه مطلب »
- استرچ فیلم | چاپ و تجهیزات گرافیک | ماشین آلات بسته بندی
- Wenzhou
- چین
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... ادامه مطلب »
- چاپ و تجهیزات گرافیک | مقاله ماشین آلات پردازش | ابزار و ماشین آلات برای فلز تراش...
- Cangzhou
- چین
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... ادامه مطلب »
- چاپ و تجهیزات گرافیک | تجهیزات لیزری
- Shenzhen
- چین
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... ادامه مطلب »
- تمیز کردن تجهیزات | چاپ و تجهیزات گرافیک
- Taixing
- چین
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... ادامه مطلب »
- چاپ و تجهیزات گرافیک | سایر تجهیزات حمل و نقل مواد
- Wenzhou
- چین
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... ادامه مطلب »
- کیسه های ساخت ماشین آلات | چاپ و تجهیزات گرافیک
- Ruian
- چین
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... ادامه مطلب »
- کیسه های ساخت ماشین آلات | چاپ و تجهیزات گرافیک
- Ruian
- چین
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... ادامه مطلب »
- کیسه های ساخت ماشین آلات | چاپ و تجهیزات گرافیک
- Ruian
- چین
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... ادامه مطلب »
- چاپ و تجهیزات گرافیک | محصول کاغذ سازی ماشین آلات
- Dongguan
- چین
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... ادامه مطلب »
- کیسه و کیسه و کیسه های | ماشین آلات دوخت | چاپ و تجهیزات گرافیک | ماشین آلات بسته بندی...
- Wenzhou
- چین
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... ادامه مطلب »
- ماشین آلات نساجی دیگر | چاپ و تجهیزات گرافیک
- Ahmedabad
- هند
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... ادامه مطلب »
- کیسه های ساخت ماشین آلات | چاپ و تجهیزات گرافیک | ماشین آلات بسته بندی...
- Vadodara
- هند
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... ادامه مطلب »
- ماشین آلات نساجی به پایان رساندن | چاپ و تجهیزات گرافیک | ماشین آلات بسته بندی...
- Ahmedabad
- هند
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... ادامه مطلب »
- چاپ و تجهیزات گرافیک | کیسه های سیمان | تجهیزات برق و الکترونیک
- Ahmedabad
- هند