Резултати од пребарувањето за: Опрема за печатење и графички дизајн
Најде 277 компанииСклопот огласи поврзани со: Опрема за печатење и графички дизајн
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн | Хартија сортирање машини и опрема | Поставување машини (la...
- Hyderabad
- Индија
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Amravati
- Индија
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Mumbai
- Индија
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Faridabad
- Индија
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Прочитај повеќе »
- Други текстилни машини | Опрема за печатење и графички дизајн | Картон Машини за изработка, континуирано, цилиндар | Mou...
- Mumbai
- Индија
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Bardoli
- Индија
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Ahmedabad
- Индија
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Pune
- Индија
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Kalol
- Индија
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Опрема за печатење и графички дизајн | Преси за печатење, цилиндар, една револуција | Преси за печатење, цилиндар, две-р...
- Wadhwan
- Индија
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Прочитај повеќе »
- Чанти | Влажни испаруваат машини, текстил | Сува испаруваат машини, текстил | Испаруваат апарати, низок притисок, тексти...
- New Delhi
- Индија
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Прочитај повеќе »
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Ilkal
- Индија
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Увозниците-извозници, хартија | Тоалетна хартија | Салфетки, марамчиња и лицето ткиво, целулозна вата | Тоалетна хартија...
- Jodhpur
- Индија
globalcatalog.com/laxmiudyog.in
- Безбедносен производ агенти | Трансфер печатење | Шприц услуги, метал | Материјали за изолација | Пружини - развој на пл...
- Mumbai
- Индија
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Прочитај повеќе »
- Водоводната | Кранови со топчест портата вентили | Дроселни кранови | Подвижни ленти, влакна цемент | Оптички производи ...
- Howrah
- Индија
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Хартија Машини за обработка на | Принтери и врзива...
- Ahmedabad
- Индија
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Прочитај повеќе »
- Водат филм | Опрема за печатење и графички дизајн | Машини за пакување...
- Wenzhou
- Кина
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Хартија Машини за обработка на | Ракуваат машини за мелење на металите...
- Cangzhou
- Кина
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Ласерска опрема
- Shenzhen
- Кина
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Прочитај повеќе »
- Опрема за чистење | Опрема за печатење и графички дизајн
- Taixing
- Кина
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Друг материјал опрема за ракување...
- Wenzhou
- Кина
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Ruian
- Кина
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Ruian
- Кина
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн
- Ruian
- Кина
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Хартија производ машини
- Dongguan
- Кина
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Прочитај повеќе »
- Торби и кеси | Машини за шиење | Опрема за печатење и графички дизајн | Машини за пакување...
- Wenzhou
- Кина
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Прочитај повеќе »
- Други текстилни машини | Опрема за печатење и графички дизајн
- Ahmedabad
- Индија
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Прочитај повеќе »
- Торба правење машини | Опрема за печатење и графички дизајн | Машини за пакување...
- Vadodara
- Индија
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Прочитај повеќе »
- Машини за изработка на доработка на текстилни материјали | Опрема за печатење и графички дизајн | Машини за пакување...
- Ahmedabad
- Индија
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Прочитај повеќе »
- Опрема за печатење и графички дизајн | Вреќи цемент | Електрична и електронска опрема...
- Ahmedabad
- Индија