Резултати претраге: Ципеле, прибор
Фоунд 579 компанијеСродне категорије
globalcatalog.com/babyfootwears.au
globalcatalog.com/ozdenkimyaveplastiksanayiticaretsti.tr
Our company Ozden Group is a Turkish leading professional manufacturer and exporter of shoe and leather care products under the brand name of SMART and VILO, located in Ankara. Also our company is... Прочитајте више »
- Чишћење опреме | Ципела дезодоранс | Пластика - паковање | Боје и лакови | Детерџенти...
- Ankara
- Турска
globalcatalog.com/shoesmanufacturerchina1.cn
Shoes Manufacturer China
Address: HAOJIASHIQIAO 23, HUANGDAO DISTRICT, QINGDAO, CHINA
Phone: +86 13854238922
Email: sara.wang@qdbestrade.com
Website: https://www.qd-bestrade.com/
There... Прочитајте више »
- Ципеле Обрада Услуге | Ципеле Дизајн Услуге | Ципеле, спорт и слободно време | Ципеле и прибор | Ципеле, произвођачи...
- HUANGDAO DISTRICT
- Кина
globalcatalog.com/uabatshoes.gb
The online cheap shoes Uabat website sells two versions of self-made replica shoes, one is top quality Uabat shoes and the other is high quality Og shoes.In short, the quality of UABAT is the... Прочитајте више »
- Патике | Ципеле | Мушке патике | Ципеле берза | Ципеле и опрема
- London
- Велика Британија
globalcatalog.com/smcpasialimited.hk
Known for its clean lines and sophisticated aesthetic, Sandro is a leading accessible luxury Parisian brand featuring refined and versatile men’s and women’s collections. Evelyne Chetrite, founder and... Прочитајте више »
- Мушкој одећи | Женска одећа | Ципеле и прибор
- Hong Kong
- Хонг Конг
globalcatalog.com/eagletrade.us
globalcatalog.com/colliniatomidiscarpasrl.it
Collini Atomi di Scarpa S. R. L. Has been an Italian leading supplier of footwear accessories, shoes accessories, leather goods accessories, clothing accessories and jewellery since 1943.
We can... Прочитајте више »
- Ципела дрвеће | Кожа и обућа - залихе и прибор
- Noventa Padovana
- Италија
globalcatalog.com/xiamejoyforceelectronicsco.cn
Established in 2003, Xiamen Joyforce Electronics Co., Ltd. (Joyforce) is a professional manufacturer and exporter of healthcare massagers in China. Our company attained ISO9001 Quality System... Прочитајте више »
- Четке за ципеле | Масажа опрема и инструменти - | Лепота бригу - инструменти...
- Xiamen
- Кина
globalcatalog.com/tanishqworld.in
Established in 1998 , TANISHQ WORLD is a reputed company in India, have craved a niche amongst manufacturers and exporters with their signature range of executive Scarves, Stoles, Shawls, Pareos,... Прочитајте више »
- Азија и Пацифик острва одеће | Етничке Текстила | Ципела етикете и ознаке...
- New Delhi
- Индија
globalcatalog.com/westinghouseusajetindia.in
Rich domain expertise combined with tremendous excellence in product innovation is the driving force of A-1 Jet India. Incepted in the year 1993, we are counted among the major global providers of... Прочитајте више »
- Пречишћивача ваздуха | Ципела полирање опрема | Завесе
- Mumbai
- Индија
globalcatalog.com/stylensteelincpvt.in
Style N Steel Inc. ( An ISO 9001:2008 Company) , BSCI Audited , Sedex , Social Ethical Compliance Factory
Style N Steel Inc. was born with clear intention of carving its niche in International... Прочитајте више »
- Ципела рогови | Кошарство | Корпоративни и промотивни поклони
- Delhi
- Индија
globalcatalog.com/yifengindustrialtradingco.cn
Our marketing tenet is "stable quality and being professional in integrative cooperation all the time".
Established August 2000, we are located in ''The Knife Scissors... Прочитајте више »
- Комплет за негу обуће
- Yangjiang
- Кина
globalcatalog.com/yangzhoukingstonetoysco.cn
Yangzhou Kingstone Toys Co., Ltd. is sub-company of Yangzhou Kingdom Arts and Crafts Co., Ltd., located in the ancient city - Yangzhou, which is famous for stuffed toys, caps and shoes.
We are a... Прочитајте више »
- Пертле
- Yangzhou
- Кина
globalcatalog.com/xiamencenxingimportexportco.cn
Xiamen Cenxing Import Export Co., Ltd. is a leading pet products manufacturer. We mainly focus on pets toys, pets furniture, pets houses, pets beds, pet apparel, cats trees and related pets... Прочитајте више »
- Пертле
- Xiamen
- Кина
globalcatalog.com/guangzhoujinyeshangdianfashionaccessoriesco.cn
Guangzhou Jinye Shangdian Fashion Accessories Co.,Ltd are mainly engaged in promotion gift, mobile phone accessory,fashion accessory,fashion jewelry and handcraft gift.
Excellent handmade craft... Прочитајте више »
- Пертле
- Guangzhou
- Кина
globalcatalog.com/yangjiangxinchengindustrytradeco.cn
Yangjiang Xingcheng Industry and trade Co., Ltd. is a premium enterprise manufacturing and exporting kitchenware. Our products are Kitchen gadgets, Knives Scissors, BBQ tools, Cake Modes and other... Прочитајте више »
- Ципела рогови
- Yangjiang
- Кина
globalcatalog.com/qingdaojoyeehousewaresco.cn
JOYEE Housewares Co., Ltd. is a professional manufacturer and exporter specialized in producing various aromatic red cedar accessores as well as hardwood shoe care articles. With years' of... Прочитајте више »
- Комплет за негу обуће
- Qingdao
- Кина
globalcatalog.com/lixianmeiyuancosmeticlimitedcorporation.cn
Founded in 2001, Lixian Meiyuan Cosmetic Limited Corporation is a private enterprise located in the south of Baoding City, Hebei Province. We are close to Beijing and Tianjin, and we have a big... Прочитајте више »
- Комплет за негу обуће
- Baoding City
- Кина
globalcatalog.com/allwinbrushes.in
India's One of the biggest manufacturers of brushes, Mops, Wipers, brooms, cotton mops etc.
Cleaning brushes of all types made by CNC machines from Belgium and Germany with very high output... Прочитајте више »
- Четке за ципеле | Детерџенти | Челична жица, бодљикава
- Agra
- Индија
globalcatalog.com/sunsumhouseholdco.cn
Sunsum Household Co., Ltd. is a professional plastic household product manufacturer in China. Our products have been exported to many countries and regions around the world, such as Germany, France,... Прочитајте више »
- Инсолес
- Ningbo
- Кина
globalcatalog.com/wujiangcitylidalustrefinishedproductsco.cn
We are a leading shoe polishing product manufacturer in China.
Our products are tin shoe polish, liquid polish, cream polish, self shine sponge, and aerosol shoe care.
We are the factory engaged... Прочитајте више »
- Инсолес
- Wujiang
- Кина
globalcatalog.com/zhongshanemartnonwovenshoesmaterialsco.cn
Zhongshan E-Mart Non-Wovenshoes Materials Co., Ltd. specializes in producing non-woven materials, normal non-woven insoles, Strobel PP antistatic insoles, Strobel materials, imitation leather,... Прочитајте више »
- Инсолес
- Zhongshan
- Кина
globalcatalog.com/foshancitylinzhishoesmaterialcolzinsole.cn
Foshan Linzhi Shoes Material Co., Ltd. located in Foshan, Guangdong, is specialized in manufacturing Shoe Materials.
LZ INSOLE With an experienced and professional team, With our own... Прочитајте више »
- Инсолес
- Foshan
- Кина
globalcatalog.com/shenzhenpowerpluselectronicsco.cn
Power Plus founded in 1998 AD, from a 10 staffs to over 4,000 employee, based on our principal: look quality as
our life. amoong the 4,000, there are 1500 QC staffs and 120 RD staffs engaged to... Прочитајте више »
- Инсолес
- Shenzhen
- Кина
globalcatalog.com/dongguanhoujiehuntshoesmaterialfactory.cn
Dongguan Houjie Hunt Shoes Material Factory was started from 2004, specializing in providing memory foam pillows, mouse pads and insoles. They are all eco-friendly, healthy and comfortable products.... Прочитајте више »
- Инсолес
- Dongguan City
- Кина
globalcatalog.com/quanzhouzhenghannonwoventechnologyco.cn
Quanzhou Zhenghan Nonwoven Technology CO.,LTD., a HONG KONG-owned Enterprise established in the year of 2002. The company is a technical enterprise focusing on non woven fabric, with a variety of... Прочитајте више »
- Инсолес
- Jinjiang
- Кина
globalcatalog.com/shenzhensaiengelproductco.cn
Established in 2007, our factory is a professional manufacturer engaged in producing PU gel and PU foam products. Our main products include the gel insoles, gel sticky pads, gel mats, gel pillows... Прочитајте више »
- Инсолес
- Shenzhen
- Кина
globalcatalog.com/jitaifujiansportsgoodsco.cn
JiTai (FuJian) Sports Goods Co., Ltd. owns abundant technologies, complete management systems, wide sales network, and perfect post-sale services. Stressing the prestige and providing our customers... Прочитајте више »
- Инсолес
- Zhangzhou
- Кина
globalcatalog.com/beijingsierzutuotechnologyco.cn
Beijing Sierzutuo Technology Co., Ltd. is a professional manufacturer of GEL insoles in China, which is specialized in study, production and sales of all kinds of foot care products with different... Прочитајте више »
- Инсолес
- Beijing
- Кина
globalcatalog.com/dongguanxinhuayefibertechnologyco.cn
Dongguan Xinhuaye Fiber Technology Co., Ltd. is a private enterprise specializing in the production of insole boards and shankboard. Our company is located in Zhongtang Town of Dongguan City.... Прочитајте више »
- Инсолес
- Dongguan
- Кина