Loading...
Torthaí Cuardaigh le haghaidh: Priontáil agus trealamh grafaicí
277 comhlachtaí AimsíodhLiostaí Rogha a bhaineann le: Priontáil agus trealamh grafaicí
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Read More »
- Innealra mála a dhéanamh | Priontáil agus trealamh grafaicí | Innealra sórtáil Páipéar agus trealamh | Meaisíní leagan (...
- Hyderabad
- An India
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Amravati
- An India
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Mumbai
- An India
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Faridabad
- An India
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Read More »
- Innealra éadaí Eile | Priontáil agus trealamh grafaicí | Meaisíní Cairtchlár, leanúnach, sorcóir | Múnlaí, sorcóir, a dh...
- Mumbai
- An India
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Bardoli
- An India
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Ahmedabad
- An India
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Pune
- An India
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Kalol
- An India
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Priontáil agus trealamh grafaicí | Cófraí priontáil, sorcóir, singil-réabhlóid | Cófraí priontáil, sorcóir, dhá-réab...
- Wadhwan
- An India
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Read More »
- Málaí | Meaisíní steaming fliuch, teicstíle | Meaisíní steaming Dry, teicstíle | Fearais steaming, brú íseal, teicstíle ...
- New Delhi
- An India
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Read More »
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Ilkal
- An India
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Allmhaireoirí-onnmhaireoirí, páipéar | Páipéar leithris | Naipcíní, ciarsúir agus fíocháin facial, flocas ceallalóis | P...
- Jodhpur
- An India
globalcatalog.com/laxmiudyog.in
- Gníomhairí táirge Slándáil | Priontáil aistriú | Seirbhísí mhúnlú insteallta, miotail | Ábhair insliú | Custom dearadh S...
- Mumbai
- An India
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Read More »
- Cúpláin | Comhlaí liathróid | Féileacán comhlaí | Criosanna iompair, stroighin shnáithíneach | Táirgí stroighin Snáithín...
- Howrah
- An India
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Read More »
- Priontáil agus trealamh grafaicí | Innealra phróiseála Páipéar | Printéirí & ceangláin
- Ahmedabad
- An India
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Read More »
- Scannán Sín | Priontáil agus trealamh grafaicí | Innealra pacáistiú
- Wenzhou
- An tSín
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Read More »
- Priontáil agus trealamh grafaicí | Innealra phróiseála Páipéar | Uirlisí meaisín do shaoirsiú miotail muilleoi...
- Cangzhou
- An tSín
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Read More »
- Priontáil agus trealamh grafaicí | Trealamh Laser
- Shenzhen
- An tSín
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Read More »
- Glanadh Trealamh | Priontáil agus trealamh grafaicí
- Taixing
- An tSín
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Read More »
- Priontáil agus trealamh grafaicí | Ábhar eile a láimhseáil trealaimh
- Wenzhou
- An tSín
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Read More »
- Innealra mála a dhéanamh | Priontáil agus trealamh grafaicí
- Ruian
- An tSín
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Read More »
- Innealra mála a dhéanamh | Priontáil agus trealamh grafaicí
- Ruian
- An tSín
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Read More »
- Innealra mála a dhéanamh | Priontáil agus trealamh grafaicí
- Ruian
- An tSín
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Read More »
- Priontáil agus trealamh grafaicí | Innealra táirge páipéar a dhéanamh
- Dongguan
- An tSín
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Read More »
- Saic agus málaí | Innill fuála | Priontáil agus trealamh grafaicí | Innealra pacáistiú
- Wenzhou
- An tSín
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Read More »
- Innealra teicstíle Eile | Priontáil agus trealamh grafaicí
- Ahmedabad
- An India
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Read More »
- Innealra mála a dhéanamh | Priontáil agus trealamh grafaicí | Innealra pacáistiú
- Vadodara
- An India
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Read More »
- Innealra teicstíle-críochnú | Priontáil agus trealamh grafaicí | Innealra pacáistiú
- Ahmedabad
- An India
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Read More »
- Priontáil agus trealamh grafaicí | Málaí Stroighne | Trealamh leictreach agus leictreonach
- Ahmedabad
- An India