Loading...
Search Results for: Chemicals & Pharmaceuticals
Found 102 companiesRelated categories
Preferred listings related to: Chemicals & Pharmaceuticals
globalcatalog.com/neerajenterprise.in
Neeraj traders is a name synonymous with wholesale export and supply of high quality herbs from india, botanical herbs, natural herbal extracts, indian spices, oil belum, sesame seeds, dried flowers,... Read More »
- Seed processing for propagation | Growing of spices, aromatic, drug and pharmaceutical crops | Ayurvedic treatment |...
- New Delhi, Delhi
- India
globalcatalog.com/natural.sk
We are a Slovak manufacturing company dealing with production of vitamins & food suplements. We offer you earning with your own private label. You can also choose from an endless mix of... Read More »
- Production of pharmaceuticals | Collagen | Minerals | Vitamins | Vitamin a | Vitamin b | Vitamin c | Vitamin d |...
- Spišská Nová Ves
- Slovakia
globalcatalog.com/procana.us
Founded in 2013, Procana has been on the forefront of cannabinoid research and development, providing controlled dosage applications of its medicinal products. Procana is engaged in multiple medical... Read More »
- Production of pharmaceuticals | Medicines | Healthcare supplement
- Miramar
- United States
globalcatalog.com/bioduro.us
BioDuro is a leading, global life sciences research and development organization with locations in San Diego, Beijing, and Shanghai that provide biopharmaceutical clients and partners with... Read More »
- Spray drying of pharmaceuticals | Contractors to the chemical and pharmaceutical industries | Emulsions, pharmaceutical...
- San Diego
- United States
globalcatalog.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... Read More »
- Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein purification services | Extraction and...
- New Delhi
- India
globalcatalog.com/schwitzbiotech.in
An ISO 9001: 2000 certified company, established in the year 1998, Schwitz Biotech, is engaged in processing and exporting of a wide range of pharmaceutical formulations to our clients that includes... Read More »
- Production services, dietary supplements | Importers-exporters, pharmaceuticals and medical supplies |...
- Ahmedabad
- India
globalcatalog.com/kochmodularprocess.us
Koch Modular Process is a design-build company specializing in the modular construction for chemical mass transfer systems. Whether it is the design and construction of distillation equipment &... Read More »
- Plant engineering design services | Contractors to the chemical and pharmaceutical industries | Pilot plant, chemical...
- Paramus
- United States
globalcatalog.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Pune
- India
globalcatalog.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... Read More »
- Industrial facilities - design | Powder technology consultants | Spray drying services for the food industry | Spray...
- Tonbridge
- United Kingdom
globalcatalog.com/kellyservices.fr
- Meteorological consultants | Steam power consultants | Geophysics consultants | Hydrogeology consultants | Groundwater...
- Clichy
- France
globalcatalog.com/univar.fr
- Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
- Fontenay-sous-Bois
- France
globalcatalog.com/sofresidengineering.fr
- Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
- Montigny-le-Bretonneux
- France
globalcatalog.com/aircontrolsa.es
- Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
- San Sebastián
- Spain
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
- Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
- Runcorn
- United Kingdom
globalcatalog.com/ktronfrance.fr
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- Croissy-sur-Celle
- France
globalcatalog.com/epiingredients.fr
- Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
- Ancenis
- France
globalcatalog.com/azelisfrance.fr
- Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
- Paris
- France
globalcatalog.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... Read More »
- Blending of pharmaceuticals | Preparations for nervous system disorders, sedatives, tranquillisers, Chinese medicine |...
- Hyderabad
- India
globalcatalog.com/borgessa.es
- Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
- Reus
- Spain
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- New Delhi
- India
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bengaluru
- India
globalcatalog.com/lgobbisrl.it
- Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
- CAMPO LIGURE (GE)
- Italy
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
globalcatalog.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
globalcatalog.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Chennai
- India
globalcatalog.com/ashvarshafinechemicalspvt.in
Manufacturer and Exporters of Pharmaceutical Intermediates and Drugs Like 2-Acetylbenzoic Acid, 2-Amino-5-bromobenzoic, 2-Amino-6-methylbenzoic Acid, 2-Amino-5-bromothiazole,... Read More »
- Extraction and purification of human hormones | Biopsy capsules | Succinyl glycyrrhetic acid for pharmaceuticals |...
- Hyderabad
- India
globalcatalog.com/irelspolsro.cz
- Production services, dietary supplements | Packaging services for the transportation of chemicals | Blending of...
- Miroslav
- Czech Republic
globalcatalog.com/corquimiaindustrialsl.es
- Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
- Esplugues de Llobregat
- Spain
globalcatalog.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- New Delhi
- India
globalcatalog.com/przedstswicielstwoallgaiermogensenswieslawstrobinallgaiermogensen.pl
- Spray drying services for the food industry | Industrial equipment hire | Spray drying of pharmaceuticals | Drying of...
- Lodz
- Poland